PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_12.58
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 748aa    MW: 80553.7 Da    PI: 6.4427
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_12.58genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.13.2e-32322379260
                                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                  dDgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers+ +++++ei+Y+g Hnh+k
  evm.model.supercontig_12.58 322 DDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSH-EGHITEIIYKGAHNHPK 379
                                  8****************************************.***************85 PP

2WRKY103.71e-32538596159
                                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                  ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  evm.model.supercontig_12.58 538 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCTVRKHVERASHDLKSVITTYEGKHNHD 596
                                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.606316380IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-28319380IPR003657WRKY domain
SuperFamilySSF1182901.23E-25319380IPR003657WRKY domain
SMARTSM007743.5E-36321379IPR003657WRKY domain
PfamPF031068.2E-25322378IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.6E-37523598IPR003657WRKY domain
SuperFamilySSF1182901.7E-28530598IPR003657WRKY domain
PROSITE profilePS5081138.664533598IPR003657WRKY domain
SMARTSM007741.5E-37538597IPR003657WRKY domain
PfamPF031066.8E-25539596IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MAGIEDNIAI IGDWVPPSPS PRTFFTAMLG EDMSSKFMSE ALPDNKTEGL FLGSREQMRS  60
GETHKKSLRE MGDQSAELGL ISEQKSSSRG GLGERIAARA GFNAPKLNTE NIRSADLSSN  120
PDVRSPYLTI PAGLSPTTLL DSPVFLSNSL AQPSPTTGKF SFLPNGNDRS STLTSEVLDK  180
NKDNFFEDIG ASSFAFKPIV ESNPSFFLGA TNRIVRNPAT LPQQSFPSIE VSVQSENSLQ  240
SQNAEAAKVH SQNRNILPFQ ADFARLSAEK DHGSNTGAAN HRVPDAVGGA AELSPPLDDQ  300
QDDDQRGSGD SLAGGGGSAP SDDGYNWRKY GQKQVKGSEY PRSYYKCTHP NCQVKKKVER  360
SHEGHITEII YKGAHNHPKP PPNRRSAIGS SNPVLDMQID GPEQPGQQNG IDGDSIWANT  420
QKGTASGTPD WRHDNVEVTS SATLGPEYGN QSAALHAQNG AQLESGDAID ASSTFSNDED  480
EEDRATHGSV SLGYEGEGDE SESKRRKIEA YATEISGATR AIREPRVVVQ TTSEVDILDD  540
GYRWRKYGQK VVKGNPNPRS YYKCTSAGCT VRKHVERASH DLKSVITTYE GKHNHDVPAA  600
RNSSHVNSGN SSSIAGQAAS AIQSHIHRPE SSQVHNSMAR FERPAAFGSF TLPGRQQLGH  660
SPGFSFGMNQ AGFTNLAMAG LGPGQAKLPV LPVHPYLAQQ RQVNEMGFML PKGEPKVEPM  720
SEPGLNLSNS SSAYQQIISR LPLGPQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-34322599878Probable WRKY transcription factor 4
2lex_A2e-34322599878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007020303.10.0WRKY DNA-binding protein 2 isoform 3
RefseqXP_007020304.10.0WRKY DNA-binding protein 2 isoform 3
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLA0A061FBG50.0A0A061FBG5_THECC; WRKY DNA-binding protein 2 isoform 3
STRINGVIT_19s0015g01870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79542740
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2